PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000133412
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 288aa    MW: 33221.3 Da    PI: 8.9468
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000133412genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.2e-194895148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+ +G g+W+++ar  g++R +k+c++rw +yl
    MDP0000133412 48 KGPWTAEEDRLLIEYVRVHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 95
                     79********************************************97 PP

2Myb_DNA-binding53.74.9e-17101145147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ ++vd+++++G++ W+tIar ++ gRt++++k++w+++
    MDP0000133412 101 RGQITPHEERIIVDLHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 145
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8164399IPR017930Myb domain
SuperFamilySSF466892.51E-3045142IPR009057Homeodomain-like
SMARTSM007171.1E-164797IPR001005SANT/Myb domain
PfamPF002492.5E-174895IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2449102IPR009057Homeodomain-like
CDDcd001672.98E-125095No hitNo description
PROSITE profilePS5129419.764100150IPR017930Myb domain
SMARTSM007171.1E-14100148IPR001005SANT/Myb domain
PfamPF002491.2E-13101145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-24103149IPR009057Homeodomain-like
CDDcd001672.33E-10105146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MIFLRDQMTR TSNSGKHRED FENDSKLTDG ITKSTYGLGL IEEEGWRKGP WTAEEDRLLI  60
EYVRVHGEGR WNSVARLAGL KRNGKSCRLR WVNYLRPDLK RGQITPHEER IIVDLHARWG  120
NRWSTIARSL PGRTDNEIKN YWRTHFKKKA AKAASDASEK VKTRLLRRQQ FYQQQQHQQL  180
NQADLKKIMA LLDENDNNKI PSCWPQVKPD SETSTTTVCP HTADQEQGFF SSMLHGNVYV  240
PEPASTNEEN FLWDGLWNLD DIHGNFNPTS ACATGKTSLH SNLVVPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-274815027128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009358046.11e-172PREDICTED: myb-related protein 305-like
TrEMBLM5XSD51e-131M5XSD5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s17350.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-80myb domain protein 79